LL-37 5mg

(36 customer reviews)

$41.00

LL-37 is supplied as a catalogued research material in 5 mg.

The assigned identity is the human 37-residue CAMP-derived peptide with free termini. Shorter cathelicidin fragments, scrambled LL-37 controls, terminally modified analogues and salt forms are distinct materials.

Chemical properties and registry information

Property Value
Name and synonyms Cathelicidin (human), hCAP18 (37-residue C-terminal fragment), FALL-39
Material category Antimicrobial Peptide
Sequence H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
Molecular formula C205H340N60O53
Average molecular mass 4493.33 g/mol
CAS Registry Number 204646-31-9
PubChem CID CID 16132337
Structural features Linear peptide, 37 amino acids. Forms an amphipathic alpha-helix.
Appearance White to off-white lyophilised powder
Solubility Soluble in sterile water or dilute aqueous buffers.
Physical form Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS.

Registry values apply only to the specific molecular entity, sequence, termini and material form. Batch records take precedence over family-level literature identifiers.

The only human cathelicidin, LL-37 is a 37-residue peptide cleaved from the C-terminus of the human cathelicidin antimicrobial protein (hCAP18).

Research background and published evidence

Published research

LL-37 has been studied in vitro in membrane-interaction, microbial, innate-immune and cell-signalling systems. Its conformation and measured response vary strongly with ionic strength, matrix composition, peptide concentration and aggregation state.

Current scientific understanding

The cited mechanistic studies do not authenticate this batch or establish human-use outcomes. Results are highly model- and condition-dependent and cannot be transferred between LL-37, precursor hCAP18, fragments or modified analogues.

Technical comparison

Aspect This catalogue material Comparator
Identity Mature human LL-37 sequence, 37 residues hCAP18: longer human cathelicidin precursor from which LL-37 is proteolytically released
Structural distinction Defined C-terminal 37-residue processed peptide hCAP18 includes an N-terminal cathelin domain and is not analytically interchangeable with LL-37
Analytical implication Confirm intact mass, sequence, purity, terminal form, counter-ion and aggregation profile Functional assay overlap cannot distinguish full-length LL-37 from fragments, scrambled controls or aggregates

Quality and testing

Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.

Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.

Laboratory handling and storage

Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.

Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment and waste disposal should follow the applicable SDS and the institution’s approved procedures.

Regulatory and legal status

Research-use notice This material is supplied exclusively for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements.

Sources and references

  1. [1] UniProt P49913 — Cathelicidin antimicrobial peptide, human
  2. [2] PubChem CID 134611881 — human LL-37
  3. [3] Blood — LL-37 expression and innate-immune research
  4. [4] Journal of Experimental Medicine — LL-37 cell-signalling study

Frequently Asked Questions

Do the CAS number and PubChem CID apply to every batch form?

Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.

What does an analytical purity result mean?

It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.

How should the material be stored and handled?

Follow the exact label, batch CoA and SDS together with the institution’s risk assessment. Use only storage and stability information linked to the exact material form and batch.